PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G411500.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 699aa    MW: 76571.9 Da    PI: 4.5888
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G411500.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.6e-143579348
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +W+teEd  l   ++++G+++W+ Ia+ +   +t+ qc+ rw++yl
  Sevir.2G411500.4.p 35 SWSTEEDSVLRAQIALHGTDNWTIIAAQFK-DKTARQCRRRWYNYL 79
                        6****************************9.**************7 PP

2Myb_DNA-binding41.62.8e-1385128146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g W+ eEd ll +a k+lG++ W+ Ia+ +  gRt++ +k+r+ +
  Sevir.2G411500.4.p  85 KGGWSREEDMLLCEAQKLLGNR-WTEIAKVVS-GRTDNAVKNRFST 128
                         688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.4362883IPR017930Myb domain
SuperFamilySSF466897.86E-2632126IPR009057Homeodomain-like
SMARTSM007172.5E-123281IPR001005SANT/Myb domain
CDDcd001672.01E-123579No hitNo description
Gene3DG3DSA:1.10.10.601.2E-183686IPR009057Homeodomain-like
PfamPF139211.7E-143696No hitNo description
SMARTSM007174.7E-1484132IPR001005SANT/Myb domain
PROSITE profilePS5129417.03984134IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-1987133IPR009057Homeodomain-like
CDDcd001674.41E-1088129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MATGPDLSSS SGAAAAAVPD AAPGAAAKKD RHIVSWSTEE DSVLRAQIAL HGTDNWTIIA  60
AQFKDKTARQ CRRRWYNYLN SECKKGGWSR EEDMLLCEAQ KLLGNRWTEI AKVVSGRTDN  120
AVKNRFSTLC KRRAKDDEPF QENGTPCSNT NAKRVLTQTG CVTPGAASSS APMKQMRSCS  180
SDLKENIVPN MRLFGQEKGT HQDARQPLAT LSSNNQQNVN TVKSHNLVTT TTKPLLGPEQ  240
HCVKQEGNFM NKDDPKVAIL LQQADLLCSL ATKIKTDDTS QSMDEAWQQL QHHLVKKDDN  300
GMSENSESGI ASLLEELDDL IVDPYESKEE DEQKIREQNG QRQTDVENEH CTGPSQASME  360
VTSNMVPDEM MEDHTVDNCK EVSNLCTNML SRSTEACPAS ENLSEVAEDS RLQRVESTSP  420
GLTDFDDFII DPYENTEEDE QNIREQNGQI DAHDNQSYGH SQATMELTPG VAPDELMEAC  480
PADSCKEDSS LCRNVLSGSM EPCPGEEKAA STNLSEVAEE SRLQCIESTS PVLANFQTKE  540
CGETPAPEKP NEVVEDSRLQ CVEFTSPSHT VLRAKAGAET FASPRIPVVA KDSKLPSMEF  600
TSPAHTVLRT KAGAETFASP RSTVVAKDSK LPSMEFTSPA HTVATFQPYA DYADDMPTPK  660
FTASERNFLL SVIELTSPGS RPETSQQPSC KRALLNSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-293613310107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958398.10.0PREDICTED: uncharacterized protein LOC101766438
TrEMBLK3ZR940.0K3ZR94_SETIT; Uncharacterized protein
STRINGSi029124m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-85MYB family protein